Research Areas

cDNA Clones (10)
Proteins (3)
Antibodies (2)
Jump to Filters
View as table Download
FRZB (NM_001463) Human Tagged ORF Clone
RC206599

USD 420.00

In Stock

FRZB (Myc-DDK-tagged)-Human frizzled-related protein (FRZB)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
FRZB (NM_001463) Human Tagged ORF Clone Lentiviral Particle
RC206599L2V

USD 820.00

6 Weeks

Lenti ORF particles, FRZB (mGFP-tagged) - Human frizzled-related protein (FRZB), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
FRZB (NM_001463) Human Tagged ORF Clone
RG206599

USD 460.00

In Stock

FRZB (GFP-tagged) - Human frizzled-related protein (FRZB)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
FRZB (NM_001463) Human Tagged ORF Clone
RC206599L3

USD 620.00

3 Weeks

Lenti ORF clone of Human frizzled-related protein (FRZB), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
FRZB (NM_001463) Human Tagged ORF Clone
RC206599L4

USD 620.00

3 Weeks

Lenti ORF clone of Human frizzled-related protein (FRZB), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
FRZB (NM_001463) Human Tagged ORF Clone Lentiviral Particle
RC206599L4V

USD 820.00

7 Weeks

Lenti ORF particles, FRZB (mGFP-tagged) - Human frizzled-related protein (FRZB), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
FRZB (NM_001463) Human Untagged Clone
SC321786

USD 310.00

In Stock

FRZB (untagged)-Human frizzled-related protein (FRZB)

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
FRZB (NM_001463) Human Over-expression Lysate
LY400569

USD 396.00

In Stock

Transient overexpression lysate of frizzled-related protein (FRZB)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
FRZB (NM_001463) Human Tagged ORF Clone
RC206599L2

USD 620.00

3 Weeks

Lenti ORF clone of Human frizzled-related protein (FRZB), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
FRZB (NM_001463) Human Recombinant Protein
TP701082

USD 748.00

In Stock

Purified recombinant protein of Human frizzled-related protein (FRZB), Ala33-end, with C-terminal His tag, secretory expressed in HEK293 cells, 50ug

Tag C-HIS
Expression Host HEK293
FRZB Rabbit Polyclonal Antibody
TA335006

USD 375.00

5 Days

Rabbit Polyclonal Anti-FRZB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FRZB antibody: synthetic peptide directed towards the N terminal of human FRZB. Synthetic peptide located within the following region: HSTQANAILAIEQFEGLLGTHCSPDLLFFLCAMYAPICTIDFQHEPIKPC
FRZB Rabbit Polyclonal Antibody
TA335007

USD 375.00

5 Days

Rabbit Polyclonal Anti-FRZB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FRZB antibody: synthetic peptide directed towards the middle region of human FRZB. Synthetic peptide located within the following region: VVEVKEILKSSLVNIPRDTVNLYTSSGCLCPPLNVNEEYIIMGYEDEERS
FRZB (NM_001463) Human Recombinant Protein
TP762609

USD 261.00

2 Weeks

Purified recombinant protein of Human frizzled-related protein (FRZB), full length, with N-terminal GST and C-terminal His tag, expressed in E.coli, 50ug

Tag N-GST and C-HIS
Expression Host E. coli