Research Areas

View as table Download

WNT2 (Myc-DDK-tagged)-Human wingless-type MMTV integration site family member 2 (WNT2), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Lenti ORF particles, WNT2 (Myc-DDK tagged) - Human wingless-type MMTV integration site family member 2 (WNT2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, WNT2 (mGFP-tagged) - Human wingless-type MMTV integration site family member 2 (WNT2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

WNT2 (GFP-tagged) - Human wingless-type MMTV integration site family member 2 (WNT2), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human wingless-type MMTV integration site family member 2 (WNT2), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, WNT2 (Myc-DDK tagged) - Human wingless-type MMTV integration site family member 2 (WNT2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human wingless-type MMTV integration site family member 2 (WNT2), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, WNT2 (mGFP-tagged) - Human wingless-type MMTV integration site family member 2 (WNT2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

WNT2 (untagged)-Human wingless-type MMTV integration site family member 2 (WNT2), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None

Transient overexpression lysate of wingless-type MMTV integration site family member 2 (WNT2), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Lenti ORF clone of Human wingless-type MMTV integration site family member 2 (WNT2), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Rabbit Polyclonal WNT2 Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.

WNT2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T

Purified recombinant protein of Human wingless-type MMTV integration site family member 2 (WNT2), transcript variant 1, Ser128-End, with N-terminal His tag, expressed in E.coli, 50ug

Tag N-His
Expression Host E. coli

Rabbit Polyclonal Anti-WNT2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-WNT2 antibody: synthetic peptide directed towards the middle region of human WNT2. Synthetic peptide located within the following region: GSAKDSKGIFDWGGCSDNIDYGIKFARAFVDAKERKGKDARALMNLHNNR

Rabbit Polyclonal Anti-WNT2 Antibody (Internal)

Applications IHC
Reactivities Human
Immunogen WNT2 / IRP antibody was raised against synthetic 15 amino acid peptide from internal region of human WNT2. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Baboon, Monkey (100%); Marmoset, Mouse, Hamster, Guinea pig, Platypus (87%); Galago, Rat, Ferret, Elephant, Panda, Dog, Cat, Bat, Horse, Rabbit, Pig, Turkey, Chicken, Armadillo (80%).

Rabbit Polyclonal Anti-WNT2 Antibody (Internal)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen WNT2 / IRP antibody was raised against synthetic 15 amino acid peptide from internal region of human WNT2. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Baboon, Monkey, Marmoset (100%); Galago, Mouse, Rat, Ferret, Sheep, Hamster, Elephant, Panda, Dog, Bovine, Cat, Bat, Rabbit, Pig, Opossum, Guinea pig, Turkey, Chicken, Armadillo, Platypus (93%); Horse (87%).

Rabbit Polyclonal Anti-WNT2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human WNT2

Transient overexpression of WNT2 (NM_003391) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of WNT2 (NM_003391) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of WNT2 (NM_003391) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack