Rabbit polyclonal anti-TNFA antibody
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human TNFA. |
Rabbit polyclonal anti-TNFA antibody
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human TNFA. |
Rabbit polyclonal TNF Alpha antibody
Applications | IHC, WB |
Reactivities | Human, Primate |
Conjugation | Unconjugated |
Immunogen | The whole rabbit serum was prepared by repeated immunizations with recombinant human TNFa produced in E.coli. |
Rabbit polyclonal TNF alpha antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The whole rabbit serum used to produce this IgG fraction antibody was prepared by repeated immunizations with recombinant human TNFa produced in E.coli. |
Rabbit Polyclonal Anti-NFATC3 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NFATC3 antibody: synthetic peptide directed towards the N terminal of human NFATC3. Synthetic peptide located within the following region: AVFPFQYCVETDIPLKTRKTSEDQAAILPGKLELCSDDQGSLSPARETSI |
Rabbit Polyclonal TNF-alpha Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal portion of the human TNF alpha protein (between residues 100-200) [UniProt P01375] |
Carrier-free (BSA/glycerol-free) TNF mouse monoclonal antibody, clone OTI1D9 (formerly 1D9)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TNF mouse monoclonal antibody, clone OTI5H8 (formerly 5H8)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-TNF Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 57-233 amino acids of human tumor necrosis factor |
TNF mouse monoclonal antibody, clone OTI1D9 (formerly 1D9)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
TNF mouse monoclonal antibody, clone OTI1D9 (formerly 1D9), Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
TNF mouse monoclonal antibody, clone OTI1D9 (formerly 1D9), HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
TNF mouse monoclonal antibody, clone OTI1D9 (formerly 1D9)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
TNF mouse monoclonal antibody, clone OTI1C1 (formerly 1C1)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
TNF mouse monoclonal antibody, clone OTI1H3 (formerly 1H3)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 399.00
In Stock
TNF-A biotinylated detection antibody, ELISA and Luminex validated mouse monoclonal antibody, clone MAb11
Applications | ELISA, LMNX |
Reactivities | Human |
Conjugation | Biotin |
Matched ELISA Pair | TA600026 |
TNFA mouse monoclonal antibody,clone OTI5A11
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
TNF mouse monoclonal antibody, clone OTI5H8 (formerly 5H8)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
TNF mouse monoclonal antibody, clone OTI5H8 (formerly 5H8), Biotinylated
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
TNF mouse monoclonal antibody, clone OTI5H8 (formerly 5H8), HRP conjugated
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | HRP |
TNF mouse monoclonal antibody, clone OTI5H8 (formerly 5H8)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
TNF mouse monoclonal antibody, clone OTI4B9 (formerly 4B9)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
TNF mouse monoclonal antibody, clone OTI3H10 (formerly 3H10)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |