WNT2 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human WNT2 |
WNT2 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human WNT2 |
Rabbit Polyclonal WNT2 Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal Anti-WNT2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-WNT2 antibody: synthetic peptide directed towards the middle region of human WNT2. Synthetic peptide located within the following region: GSAKDSKGIFDWGGCSDNIDYGIKFARAFVDAKERKGKDARALMNLHNNR |
Rabbit Polyclonal Anti-WNT2 Antibody (Internal)
Applications | IHC |
Reactivities | Human |
Immunogen | WNT2 / IRP antibody was raised against synthetic 15 amino acid peptide from internal region of human WNT2. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Baboon, Monkey (100%); Marmoset, Mouse, Hamster, Guinea pig, Platypus (87%); Galago, Rat, Ferret, Elephant, Panda, Dog, Cat, Bat, Horse, Rabbit, Pig, Turkey, Chicken, Armadillo (80%). |
Rabbit Polyclonal Anti-WNT2 Antibody (Internal)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | WNT2 / IRP antibody was raised against synthetic 15 amino acid peptide from internal region of human WNT2. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Baboon, Monkey, Marmoset (100%); Galago, Mouse, Rat, Ferret, Sheep, Hamster, Elephant, Panda, Dog, Bovine, Cat, Bat, Rabbit, Pig, Opossum, Guinea pig, Turkey, Chicken, Armadillo, Platypus (93%); Horse (87%). |
Rabbit Polyclonal Anti-WNT2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human WNT2 |
Wnt2 Antibody - C-terminal region
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |