Rabbit Polyclonal FMNL2 Antibody
Applications | IHC, WB |
Reactivities | Human, Rat, Primate |
Conjugation | Unconjugated |
Immunogen | A portion of amino acid 1-50 of human Formin-like protein 2 was used as the immunogen. |
Rabbit Polyclonal FMNL2 Antibody
Applications | IHC, WB |
Reactivities | Human, Rat, Primate |
Conjugation | Unconjugated |
Immunogen | A portion of amino acid 1-50 of human Formin-like protein 2 was used as the immunogen. |
Rabbit Polyclonal Anti-FMNL2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FMNL2 antibody is: synthetic peptide directed towards the middle region of Human FMNL2. Synthetic peptide located within the following region: RFVKAYKQAEEENELRKKQEQALMEKLLEQEALMEQQDPKSPSHKSKRQQ |
Rabbit Polyclonal Anti-FMNL2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FMNL2 antibody: synthetic peptide directed towards the N terminal of human FMNL2. Synthetic peptide located within the following region: MGNAGSMDSQQTDFRAHNVPLKLPMPEPGELEERFAIVLNAMNLPPDKAR |