Products

Jump to Filters
View as table Download
P2Y6 (P2RY6) Rabbit Polyclonal Antibody
TA327370

USD 275.00

3 Weeks

P2RY6 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human P2RY6
P2ry6 Rabbit Polyclonal Antibody
TA329000

USD 585.00

3 Weeks

Rabbit polyclonal Anti-P2Y6 Receptor

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide CQPHDLLQKLTAKWQRQRV, corresponding to amino acid residues 311-328 of rat P2Y6 receptor. Intracellular, C-terminus.
P2Y6 (P2RY6) Rabbit Polyclonal Antibody
TA334342

USD 375.00

5 Days

Rabbit Polyclonal Anti-P2RY6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-P2RY6 antibody is: synthetic peptide directed towards the N-terminal region of Human P2RY6. Synthetic peptide located within the following region: NLHGSILFLTCISFQRYLGICHPLAPWHKRGGRRAAWLVCVAVWLAVTTQ