Products

Jump to Filters
View as table Download
SAMM50 Rabbit Polyclonal Antibody
TA331956

USD 375.00

5 Days

Rabbit Polyclonal Anti-SAMM50 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SAMM50 Antibody is: synthetic peptide directed towards the N-terminal region of Human SAMM50. Synthetic peptide located within the following region: GLGRTKDDIIICEIGDVFKAKNLIEVMRKSHEAREKLLRLGIFRQVDVLI
SAMM50 Rabbit Polyclonal Antibody
TA381244

USD 220.00

3 Weeks

SAMM50 Rabbit polyclonal Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-220 of human SAMM50 (NP_056195.3).
Modifications Unmodified