Products

View as table Download

DYRK1A rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human DYRK1A

Rabbit polyclonal anti-DYR1A antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human DYR1A.

Rabbit Polyclonal DYRK1A Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen DYRK1A antibody was raised against a 17 amino acid synthetic peptide near the carboxy terminus of human DYRK1A. The immunogen is located within the last 50 amino acids of DYRK1A.

Rabbit Polyclonal Anti-Dyrk1a Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Dyrk1a antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: SFHAAGLQMAAQMPHSHQYSDRRQPNISDQQVSALSYSDQIQQPLTNQVM

Rabbit Polyclonal Anti-DYRK1A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DYRK1A antibody: synthetic peptide directed towards the N terminal of human DYRK1A. Synthetic peptide located within the following region: INEVYYAKKKRRHQQGQGDDSSHKKERKVYNDGYDDDNYDYIVKNGEKWM

DYRK1A rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human DYRK1A

DYRK1A Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 624-763 of human DYRK1A (NP_001387.2).
Modifications Unmodified