Products

View as table Download

Rabbit Polyclonal Anti-GM2A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GM2A antibody: synthetic peptide directed towards the N terminal of human GM2A. Synthetic peptide located within the following region: MQSLMQAPLLIALGLLLAAPAQAHLKKPSQLSSFSWDNCDEGKDPAVIRS

Rabbit Polyclonal Anti-GM2A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GM2A antibody: synthetic peptide directed towards the N terminal of human GM2A. Synthetic peptide located within the following region: SWDNCDEGKDPAVIRSLTLEPDPIIVPGNVTLSVMGSTSVPLSSPLKVDL

Rabbit Polyclonal Anti-GM2A Antibody (Internal)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen GM2A antibody was raised against synthetic 15 amino acid peptide from internal region of human GM2A. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon (100%); Monkey, Marmoset (93%).

GM2A rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human GM2A

GM2A rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human GM2A

GM2A Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 24-193 of human GM2A (NP_000396.2).
Modifications Unmodified