Products

View as table Download

Rabbit Polyclonal APC8 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen APC8 antibody was raised against a 17 amino acid synthetic peptide near the center of human APC8.

Rabbit polyclonal anti-APC8 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human APC8.

Rabbit Polyclonal Anti-IRF6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-IRF6 Antibody: synthetic peptide directed towards the C terminal of human IRF6. Synthetic peptide located within the following region: FLSDLIAHQKGQIEKQPPFEIYLCFGEEWPDGKPLERKLILVQVIPVVAR

Rabbit Polyclonal Anti-CDC23 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human CDC23

CDC23 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human CDC23

CDC23 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human CDC23