Products

View as table Download

Rabbit Polyclonal Anti-CXCL14 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human CXCL14

Anti-Human BRAK Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human BRAK (CXCL14)

Biotinylated Anti-Human BRAK Rabbit Polyclonal Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human BRAK (CXCL14)

Rabbit Polyclonal Anti-CXCL14 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CXCL14 antibody: synthetic peptide directed towards the middle region of human CXCL14. Synthetic peptide located within the following region: PHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYE

Rabbit Polyclonal Anti-CXCL14 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CXCL14 antibody: synthetic peptide directed towards the middle region of human CXCL14. Synthetic peptide located within the following region: HCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE