Rabbit Polyclonal Anti-FBXO16 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FBXO16 antibody: synthetic peptide directed towards the N terminal of human FBXO16. Synthetic peptide located within the following region: CRKLQEKIPAEALDFTTKLPRVLSLYIFSFLDPRSLCRCAQVCWHWKNLA |
Rabbit Polyclonal Anti-FBXO16 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FBXO16 antibody: synthetic peptide directed towards the C terminal of human FBXO16. Synthetic peptide located within the following region: SPLSAFRSSSSLRKKNNSGEKALPPWRSSDKHPTDIIRFNYLDNRDPMET |
Germany
Japan
United Kingdom
China