PPM1H (Center) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 235~263 amino acids from the Central region of Human PPM1H |
PPM1H (Center) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 235~263 amino acids from the Central region of Human PPM1H |
Rabbit Polyclonal Anti-PPM1H Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-PPM1H antibody is: synthetic peptide directed towards the N-terminal region of Human PPM1H. Synthetic peptide located within the following region: TRRLPWATGYAEVINAGKSTHNEDQASCEVLTVKKKAGAVTSTPNRNSSK |