Anti-REST Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around aa.873~877(R-E-E-A-S) derived from Human REST. |
Anti-REST Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around aa.873~877(R-E-E-A-S) derived from Human REST. |
Rabbit Polyclonal Anti-REST Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-REST antibody: synthetic peptide directed towards the middle region of human REST. Synthetic peptide located within the following region: PMLPPSAVEEREAVSKTALASPPATMAANESQEIDEDEGIHSHEGSDLSD |