Germany
Japan
United Kingdom
China
NPTN (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 79-108 amino acids from the N-terminal region of human NPTN |
Products
View as table Download
Rabbit Polyclonal Anti-NPTN Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NPTN antibody: synthetic peptide directed towards the middle region of human NPTN. Synthetic peptide located within the following region: MEYRINKPRAEDSGEYHCVYHFVSAPKANATIEVKAAPDITGHKRSENKN |
Rabbit polyclonal anti-NPTN antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NPTN. |
Rabbit Polyclonal Anti-NPTN Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | NPTN / SDR1 antibody was raised against synthetic 19 amino acid peptide from internal region of human NPTN. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bat, Bovine, Horse, Rabbit, Pig, Guinea pig (100%); Opossum, Turkey, Zebra finch, Chicken, Platypus, Lizard (89%); Salmon, Stickleback, Pufferfish (84%). |
Rabbit Polyclonal Anti-NPTN Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | NPTN / SDR1 antibody was raised against synthetic 16 amino acid peptide from N-terminus of human NPTN. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Rabbit (100%); Rat, Panda, Opossum (94%); Mouse, Bat, Dog, Bovine, Elephant, Pig (88%); Horse (81%). |
Rabbit Polyclonal Anti-NPTN Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NPTN antibody: synthetic peptide directed towards the middle region of human NPTN. Synthetic peptide located within the following region: SAPKANATIEVKAAPDITGHKRSENKNEGQDATMYCKSVGYPHPDWIWRK |
Active filters
Target Symbol
- NPTN
Antibody Hosts
- Rabbit
Families
- Transmembrane