Products

View as table Download

Rabbit polyclonal FYN Antibody (N-term)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This FYN antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human FYN.

Rabbit Polyclonal Fyn Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Fyn

Rabbit Polyclonal Fyn (Tyr530) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Fyn around the phosphorylation site of Tyrosine 530
Modifications Phospho-specific

Rabbit polyclonal Fyn (Phospho-Tyr530) antibody

Applications IHC, WB
Reactivities Human: Tyr530, Mouse: Tyr527
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Fyn around the phosphorylation site of tyrosine 530 (P-Q-YP-Q-P).
Modifications Phospho-specific

Rabbit polyclonal Fyn (Ab-530) antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Fyn around the phosphorylation site of tyrosine 530 (P-Q-YP-Q-P).

FYN pTyr530 rabbit polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Human, Mouse, Rat

FYN rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse

Rabbit polyclonal Anti-FYN Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FYN antibody: synthetic peptide directed towards the N terminal of human FYN. Synthetic peptide located within the following region: GCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYN

Rabbit polyclonal Anti-FYN Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-FYN antibody: synthetic peptide directed towards the middle region of human FYN. Synthetic peptide located within the following region: CPQDCPISLHELMIHCWKKDPEERPTFEYLQSFLEDYFTATEPQYQPGEN

Rabbit Polyclonal Anti-KYNU Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human FYN