Products

View as table Download

UNC5C (Center) rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the Center region of human UNC5C

Rabbit Polyclonal Anti-UNC5C Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UNC5C antibody is: synthetic peptide directed towards the middle region of Human UNC5C. Synthetic peptide located within the following region: EVSIEISRQQVEELFGPEDYWCQCVAWSSAGTTKSRKAYVRIAYLRKTFE

Rabbit Polyclonal Anti-UNC5C Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UNC5C antibody: synthetic peptide directed towards the middle region of human UNC5C. Synthetic peptide located within the following region: VVVALFVYRKNHRDFESDIIDSSALNGGFQPVNIKAARQDLLAVPPDLTS

Rabbit Polyclonal Anti-UNC5C Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UNC5C antibody: synthetic peptide directed towards the C terminal of human UNC5C. Synthetic peptide located within the following region: WRMLAHKLNLDRYLNYFATKSSPTGVILDLWEAQNFPDGNLSMLAAVLEE