Products

View as table Download

Phospho-PRKCB-T641 Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A phospho specific peptide corresponding to residues surrounding T641 of human PRKCB
Modifications Phospho-specific

Rabbit anti-PRKCB Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PRKCB

Anti-PRKCB (Phospho-Thr641) Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around phosphorylation site of threonine 641 (E-L-T(p)-P-T) derived from Human PKCβ
Modifications Phospho-specific

Rabbit Polyclonal Phospho-PKCB (Ser661) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human PKCB around the phosphorylation site of Serine 661
Modifications Phospho-specific

Rabbit Polyclonal PKCB Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human PKCB

Rabbit Polyclonal Antibody against PRKCB1 (C-term)

Applications IHC, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen This PKC beta2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 642-673 amino acids from the C-terminal region of human PKC beta2.

Rabbit polyclonal anti-PKC beta antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to the C-terminus of mouse PKC β1

PKC beta 1 (PRKCB) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat

Rabbit polyclonal Anti-PRKCB1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRKCB1 antibody: synthetic peptide directed towards the N terminal of human PRKCB1. Synthetic peptide located within the following region: MADPAAGPPPSEGEESTVRFARKGALRQKNVHEVKNHKFTARFFKQPTFC

Rabbit polyclonal Anti-PRKCB1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRKCB1 antibody: synthetic peptide directed towards the N terminal of human PRKCB1. Synthetic peptide located within the following region: CFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSSPTFCDHCGS

Rabbit Polyclonal Anti-PRKCB Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human PRKCB