Rabbit anti-THRB Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human THRB |
Rabbit anti-THRB Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human THRB |
Rabbit Polyclonal Anti-THR1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-THR1 Antibody: A synthesized peptide derived from human THR1 |
Rabbit polyclonal Thyroid Hormone Receptor Beta antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Thyroid Hormone Receptor β antibody. |
Modifications | Phospho-specific |
Rabbit polyclonal Thyroid Hormone Receptor beta 1 antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Anti-TR β1 antibody is affinity purified from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to a region near the N-terminal of human THRB isoform 1 protein. |
Rabbit Polyclonal Anti-THRB Antibody
Applications | 10k-ChIP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-THRB antibody: synthetic peptide directed towards the N terminal of human THRB. Synthetic peptide located within the following region: MTPNSMTENGLTAWDKPKHCPDREHDWKLVGMSEACLHRKSHSERRSTLK |
Rabbit Polyclonal Anti-Thrb Antibody
Applications | Assay, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Thrb antibody: synthetic peptide directed towards the N terminal of mouse Thrb. Synthetic peptide located within the following region: KSKDSDLDMALSQSSQPAHLPEEKPFPQVQSPPHSQKKGYIPSYLDKDEL |
Rabbit polyclonal TR-β1 (Ser142) antibody(Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human TR-β1 around the phosphorylation site of serine 142 (H-P-SP-Y-S). |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-THRB Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-THRB antibody: synthetic peptide directed towards the middle region of human THRB. Synthetic peptide located within the following region: YQDSFLLAFEHYINYRKHHVTHFWPKLLMKVTDLRMIGACHASRFLHMKV |
Rabbit Polyclonal Anti-THRB Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-THRB antibody: synthetic peptide directed towards the N terminal of human THRB. Synthetic peptide located within the following region: QSSPHLIQTTWTSSIFHLDHDDVNDQSVSSAQTFQTEEKKCKGYIPSYLD |
Rabbit Polyclonal Anti-THRB Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-THRB antibody: synthetic peptide directed towards the N terminal of human THRB. Synthetic peptide located within the following region: LHRKSHSERRSTLKNEQSSPHLIQTTWTSSIFHLDHDDVNDQSVSSAQTF |