Products

View as table Download

Rabbit Polyclonal Anti-PDE8A Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PDE8A antibody: synthetic peptide directed towards the C terminal of human PDE8A. Synthetic peptide located within the following region: VSNPCRPLQYCIEWAARISEEYFSQTDEEKQQGLPVVMPVFDRNTCSIPK

Rabbit Polyclonal Anti-PDE8A Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PDE8A antibody: synthetic peptide directed towards the C terminal of human PDE8A. Synthetic peptide located within the following region: SSNPYHNSTHSADVLHATAYFLSKERIKETLDPIDEVAALIAATIHDVDH

PDE8A Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Gibbon, Dog, Gorilla, Horse, Human, Pig, Rabbit
Conjugation Unconjugated
Immunogen PDE8A antibody was raised against synthetic 16 amino acid peptide from near N-terminus of human PDE8A. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Dog, Panda, Horse, Rabbit, Pig (100%); Marmoset (94%); Mouse, Rat, Bovine, Elephant, Opossum (88%); Platypus, Zebrafish (81%).