Products

View as table Download

Rabbit Polyclonal Anti-CNOT10 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CNOT10 Antibody is: synthetic peptide directed towards the C-terminal region of Human CNOT10. Synthetic peptide located within the following region: NVTDVSLGISSNEQDQGSDKGENEAMESSGKRAPQCYPSSVNSARTVMLF

Rabbit Polyclonal Anti-CNOT10 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CNOT10 Antibody is: synthetic peptide directed towards the C-terminal region of Human CNOT10. Synthetic peptide located within the following region: AMESSGKRAPQCYPSSVNSARTVMLFNLGSAYCLRSEYDKARKCLHQAAS