Products

Jump to Filters
View as table Download
UBA6 Rabbit Polyclonal Antibody
TA336995

USD 402.00

5 Days

Rabbit Polyclonal FLJ10808 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A portion of amino acids 775-825 of human UBE1L2 was used as the immunogen for this antibody.
UBA6 Rabbit Polyclonal Antibody
TA342595

USD 375.00

5 Days

Rabbit Polyclonal Anti-UBA6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UBA6 antibody: synthetic peptide directed towards the middle region of human UBA6. Synthetic peptide located within the following region: EVIVPHLTESYNSHRDPPEEEIPFCTLKSFPAAIEHTIQWARDKFESSFS