Products

View as table Download

Rabbit Polyclonal Anti-ATP5F1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ATP5F1 antibody: synthetic peptide directed towards the middle region of human ATP5F1. Synthetic peptide located within the following region: VTYRERLYRVYKEVKNRLDYHISVQNMMRRKEQEHMINWVEKHVVQSIST

Rabbit polyclonal anti-ATP5F1 antibody (Center)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen This ATP5F1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 161-195 amino acids from the Central region of human ATP5F1.