Products

Jump to Filters
View as table Download
PKC gamma (PRKCG) Rabbit Polyclonal Antibody
TA313070

USD 345.00

In Stock

Rabbit polyclonal anti-PRKCG antibody

Applications WB
Reactivities Human Mouse Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PRKCG.
PKC gamma (PRKCG) Rabbit Polyclonal Antibody
TA326206

USD 345.00

In Stock

Rabbit polyclonal PRKCG (Ab-655) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human PRKCG around the phosphorylation site of threonine 655 (A-L-TP-P-P).
PKC gamma (PRKCG) Rabbit Polyclonal Antibody
TA342148

USD 375.00

5 Days

Rabbit polyclonal Anti-PRKCG Antibody

Applications Assay, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PRKCG antibody: synthetic peptide directed towards the N terminal of human PRKCG. Synthetic peptide located within the following region: FVVHRRCHEFVTFECPGAGKGPQTDDPRNKHKFRLHSYSSPTFCDHCGSL
PKC gamma (PRKCG) Rabbit Polyclonal Antibody
TA350905

USD 345.00

In Stock

Rabbit Polyclonal Anti-PRKCG Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human PRKCG
PRKCG Rabbit Polyclonal Antibody
TA366921

USD 380.00

4 Weeks

PRKCG rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human PRKCG
PKC gamma (PRKCG) Rabbit Polyclonal Antibody
TA380367

USD 220.00

3 Weeks

PKC gamma Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human PKC gamma
Modifications Unmodified