Products

View as table Download

Rabbit Polyclonal Anti-Fra 2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Fra 2 Antibody: A synthesized peptide derived from human Fra 2

FRA2 (FOSL2) (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Hamster, Human
Immunogen KLH conjugated synthetic peptide between 95-122 amino acids from the Central region of Human Fos-related antigen 2

Rabbit polyclonal anti-Fra-2 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Fra-2.

Rabbit polyclonal FOSL2 Antibody (C-term)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This FOSL2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 220-248 amino acids from the C-terminal region of human FOSL2.

Rabbit Polyclonal anti-FOSL2 antibody

Applications IHC, WB
Reactivities Human, Zebrafish
Conjugation Unconjugated
Immunogen The immunogen for anti-FOSL2 antibody: synthetic peptide directed towards the middle region of human FOSL2. Synthetic peptide located within the following region: PMRSGGGSVGAVVVKQEPLEEDSPSSSSAGLDKAQRSVIKPISIAGGFY

Rabbit Polyclonal anti-FOSL2 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-FOSL2 antibody: synthetic peptide directed towards the middle region of human FOSL2. Synthetic peptide located within the following region: KLQAETEELEEEKSGLQKEIAELQKEKEKLEFMLVAHGPVCKISPEERRS

FOSL2 rabbit polyclonal antibody

Applications ELISA, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human FOSL2

FRA2 Rabbit monoclonal Antibody

Applications IP, WB
Reactivities Human
Conjugation Unconjugated