SIGLEC9 (C-term) rabbit polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 385-415 amino acids from the C-terminal region of human SIGLEC9. |
SIGLEC9 (C-term) rabbit polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 385-415 amino acids from the C-terminal region of human SIGLEC9. |
Rabbit polyclonal antibody to SIGLEC9 (sialic acid binding Ig-like lectin 9)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 273 of SIGLEC9 (Uniprot ID#Q9Y336) |
Rabbit Polyclonal Anti-SIGLEC9 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SIGLEC9 antibody: synthetic peptide directed towards the C terminal of human SIGLEC9. Synthetic peptide located within the following region: PWVHLRDAAEFTCRAQNPLGSQQVYLNVSLQSKATSGVTQGVVGGAGATA |
Rabbit Polyclonal Anti-SIGLEC9 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human SIGLEC9 |
SIGLEC9 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human SIGLEC9 |
SIGLEC9 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 210-340 of human SIGLEC9 (NP_001185487.1). |
Modifications | Unmodified |