Rabbit Polyclonal Anti-ABHD4 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Abhd4 antibody is: synthetic peptide directed towards the N-terminal region of Rat Abhd4. Synthetic peptide located within the following region: DRTPLVMVHGFGGGVGLWILNMDSLSARRTLHTFDLLGFGRSSRPTFPRD |
Rabbit polyclonal anti-ABHD4 antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ABHD4. |
ABHD4 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 223-342 of human ABHD4 (NP_071343.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China