Products

View as table Download

ACTR3 Rabbit Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat, Monkey
Conjugation Unconjugated
Immunogen Recombinant protein of human ACTR3

Rabbit polyclonal anti-ACTR3 antibody

Applications WB
Reactivities Human Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human ACTR3.

Arp3 (ACTR3) (C-term) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the C-terminal region of human ACTR3

Anti-ACTR3 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 210 amino acids of human ARP3 actin-related protein 3 homolog (yeast)

Rabbit Polyclonal Anti-ACTR3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACTR3 antibody: synthetic peptide directed towards the N terminal of human ACTR3. Synthetic peptide located within the following region: IAIKESAKVGDQAQRRVMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVE

ACTR3 Antibody - middle region

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human ACTR3

ACTR3 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle terminal region of human ACTR3

Actin Related Protein 3 Rabbit monoclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated