Rabbit Polyclonal Anti-CNOT10 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CNOT10 Antibody is: synthetic peptide directed towards the C-terminal region of Human CNOT10. Synthetic peptide located within the following region: NVTDVSLGISSNEQDQGSDKGENEAMESSGKRAPQCYPSSVNSARTVMLF |
Rabbit Polyclonal Anti-CNOT10 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CNOT10 Antibody is: synthetic peptide directed towards the C-terminal region of Human CNOT10. Synthetic peptide located within the following region: AMESSGKRAPQCYPSSVNSARTVMLFNLGSAYCLRSEYDKARKCLHQAAS |
CNOT10 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CNOT10 |
CNOT10 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CNOT10 |
CNOT10 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 465-744 of human CNOT10 (NP_056257.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
