Products

View as table Download

Rabbit monoclonal anti-COL11 antibody for SISCAPA, clone OTIR1C9

Applications SISCAPA
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-COLEC11 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human COLEC11

COLEC11 (N-term) rabbit polyclonal antibody, Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 50-78 amino acids from the N-terminal region of human COLEC11.

Rabbit Polyclonal Anti-COLEC11 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-COLEC11 Antibody is: synthetic peptide directed towards the N-terminal region of Human COLEC11. Synthetic peptide located within the following region: RETKAPPDGLEESAPREKKQSQPVVTASDISKRKCTSSFVEMGSQGDMGD

COLEC11 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human COLEC11

COLEC11 rabbit polyclonal antibody

Applications ELISA, IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human COLEC11

COLEC11 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 26-271 of human COLEC11 (NP_076932.1).
Modifications Unmodified