Products

View as table Download

Rabbit Polyclonal Anti-DIS3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-DIS3 antibody is: synthetic peptide directed towards the N-terminal region of Human DIS3. Synthetic peptide located within the following region: QTVLQEVRNRSAPVYKRIRDVTNNQEKHFYTFTNEHHRETYVEQEQGENA

Rabbit Polyclonal Anti-DIS3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DIS3 antibody: synthetic peptide directed towards the N terminal of human DIS3. Synthetic peptide located within the following region: DIVAVELLPKSQWVAPSSVVLHDEGQNEEDVEKEEETERMLKTAVSEKML

Rabbit Polyclonal DIS3 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen DIS3 antibody was raised against an 18 amino acid peptide near the amino terminus of human DIS3.

DIS3 (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 302-331 amino acids from the Central region of human DIS3

DIS3 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human DIS3

DIS3 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human DIS3 (NP_055768.3).
Modifications Unmodified