Rabbit Polyclonal DPP10 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to residues 521-539 of human DPP10. |
Rabbit Polyclonal DPP10 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to residues 521-539 of human DPP10. |
Rabbit Polyclonal Anti-DPP10 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DPP10 antibody: synthetic peptide directed towards the middle region of human DPP10. Synthetic peptide located within the following region: VNYTMQVYPDEGHNVSEKSKYHLYSTILKFFSDCLKEEISVLPQEPEEDE |
Rabbit Polyclonal Anti-DPP10 Antibody (Extracellular Domain)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Dipeptidylpeptidase 10 / DPP10 antibody was raised against synthetic 14 amino acid peptide from extracellular domain of human DPP10. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Elephant, Panda, Bovine, Dog, Bat, Horse, Rabbit, Pig (100%); Mouse, Rat, Hamster (93%); Opossum, Chicken (86%). |
Rabbit Polyclonal Anti-DPP10 Antibody (Extracellular Domain)
Applications | IHC |
Reactivities | Human |
Immunogen | Dipeptidylpeptidase 10 / DPP10 antibody was raised against synthetic 15 amino acid peptide from extracellular domain of human DPP10. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Marmoset, Bovine, Panda, Horse, Rabbit, Pig (100%); Gibbon, Dog (93%); Bat, Elephant (87%). |
Rabbit Polyclonal Anti-DPP10 Antibody (Internal)
Applications | IHC |
Reactivities | Human |
Immunogen | Dipeptidylpeptidase 10 / DPP10 antibody was raised against synthetic 17 amino acid peptide from internal region of human DPP10. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Panda, Bovine, Dog, Horse, Guinea pig (100%); Galago, Bat, Rabbit, Pig (94%); Opossum, Turkey, Zebra finch, Chicken, Xenopus (88%); Mouse, Rat, Hamster, Elephant (82%). |
DPP10 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 400-500 of human DPP10 (NP_001308842.1). |
Modifications | Unmodified |