Products

View as table Download

Rabbit Polyclonal Anti-EDAR Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EDAR antibody: synthetic peptide directed towards the middle region of human EDAR. Synthetic peptide located within the following region: PAPDKQGSPELCLLSLVHLAREKSATSNKSAGIQSRRKKILDVYANVCGV

Anti-EDAR Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 148-161 amino acids of Human Ectodysplasin-A receptor

Anti-EDAR Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 148-161 amino acids of Human Ectodysplasin-A receptor

EDAR Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 27-187 of human EDAR (NP_071731.1).
Modifications Unmodified

EDAR Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 27-187 of human EDAR (NP_071731.1).
Modifications Unmodified

Recombinant Anti-EDAR (Clone EDAR12)

Applications ELISA, WB
Reactivities Chicken, Human, Mouse, Rat, Dog
Conjugation Unconjugated
Modifications This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques.