Products

Jump to Filters
View as table Download
Factor XI (F11) (Center) Rabbit Polyclonal Antibody
AP51492PU-N

USD 512.00

2 Weeks

Factor XI (F11) (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 281-307 amino acids from the Central region of human F11.
Factor XI (F11) Rabbit Polyclonal Antibody
TA308541

USD 415.00

5 Days

Rabbit Polyclonal antibody to Factor XI (coagulation factor XI)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 312 of Factor XI (Uniprot ID#P03951)
Factor XI (F11) Rabbit Polyclonal Antibody
TA343100

USD 375.00

5 Days

Rabbit Polyclonal Anti-F11 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-F11 antibody: synthetic peptide directed towards the C terminal of human F11. Synthetic peptide located within the following region: RHLCGGSIIGNQWILTAAHCFYGVESPKILRVYSGILNQSEIKEDTSFFG