Products

View as table Download

Rabbit Polyclonal Anti-FLOT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FLOT1 antibody is: synthetic peptide directed towards the middle region of Human FLOT1. Synthetic peptide located within the following region: IREAKAKQEKVSAQYLSEIEMAKAQRDYELKKAAYDIEVNTRRAQADLAY

Rabbit Polyclonal Anti-FLOT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FLOT1 antibody is: synthetic peptide directed towards the C-terminal region of Human FLOT1. Synthetic peptide located within the following region: QQIEEQRVQVQVVERAQQVAVQEQEIARREKELEARVRKPAEAERYKLER

FLOT1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of Human FLOT1

FLOT1 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human FLOT1

Flotillin 1 Rabbit polyclonal Antibody

Applications IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 128-427 of human Flotillin 1 (NP_005794.1).
Modifications Unmodified

Flotillin 1 Rabbit polyclonal Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human Flotillin 1