Products

View as table Download

Rabbit Polyclonal Anti-SUPT16H Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SUPT16H antibody: synthetic peptide directed towards the middle region of human SUPT16H. Synthetic peptide located within the following region: EESDYSKESLGSEEESGKDWDELEEEARKADRESRYEEEEEQSRSMSRKR

Rabbit Polyclonal Anti-SUPT16H Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-SUPT16H Antibody: A synthesized peptide derived from human SUPT16H

Rabbit Polyclonal anti-SUPT16H antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SUPT16H antibody: synthetic peptide directed towards the N terminal of human SUPT16H. Synthetic peptide located within the following region: ASKKKVEFLKQIANTKGNENANGAPAITLLIREKNESNKSSFDKMIEAIK

SUPT16H Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human SUPT16H

SUPT16H (SPT16) Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human SUPT16H (SPT16).