Rabbit Polyclonal FLJ10808 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A portion of amino acids 775-825 of human UBE1L2 was used as the immunogen for this antibody. |
Rabbit Polyclonal FLJ10808 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A portion of amino acids 775-825 of human UBE1L2 was used as the immunogen for this antibody. |
Rabbit Polyclonal Anti-UBA6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UBA6 antibody: synthetic peptide directed towards the middle region of human UBA6. Synthetic peptide located within the following region: EVIVPHLTESYNSHRDPPEEEIPFCTLKSFPAAIEHTIQWARDKFESSFS |
UBA6 Antibody - C-terminal region
Applications | WB |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human UBA6 |
UBA6 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human UBA6 |
UBA6 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human UBA6 |
UBA6 Rabbit polyclonal Antibody
Applications | IF, IP, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-260 of human UBA6 (NP_060697.4). |
Modifications | Unmodified |