Products

Jump to Filters
View as table Download
MED19 Rabbit Polyclonal Antibody
TA330946

USD 375.00

5 Days

Rabbit polyclonal Anti-MED19 Antibody

Applications Assay, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-MED19 antibody is: synthetic peptide directed towards the middle region of Human MED19. Synthetic peptide located within the following region: LPGSHDNSSLRSLIEKPPILSSSFNPITGTMLAGFRLHTGPLPEQCRLMH