Products

View as table Download

Rabbit Polyclonal Anti-MED6 Antibody

Applications Assay, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-MED6 Antibody: synthetic peptide directed towards the middle region of human MED6. Synthetic peptide located within the following region: ALLLDLRQKFPPKFVQLKPGEKPVPVDQTKKEAEPIPETVKPEEKETTKN

Rabbit Polyclonal Anti-MED6 Antibody

Applications Assay, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-MED6 Antibody: synthetic peptide directed towards the middle region of human MED6. Synthetic peptide located within the following region: LLLDLRQKFPPKFVQLKPGEKPVPVDQTKKEAEPIPETVKPEEKETTKNV