Products

Jump to Filters
View as table Download
Adducin 2 (ADD2) Rabbit Polyclonal Antibody
AP20545PU-N

USD 407.00

2 Weeks

Adducin 2 (ADD2) rabbit polyclonal antibody, Aff - Purified

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 470-520 of Human Adducin β.
Adducin 2 (ADD2) Rabbit Polyclonal Antibody
TA340186

USD 375.00

5 Days

Rabbit Polyclonal Anti-ADD2 Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ADD2 antibody: synthetic peptide directed towards the middle region of human ADD2. Synthetic peptide located within the following region: VVNGREEEQTAEEILSKGLSQMTTSADTDVDTSKDKTESVTSGPMSPEGS