Products

Jump to Filters
View as table Download
Interferon regulatory factor 9 (IRF9) Rabbit Polyclonal Antibody
TA349363

USD 380.00

2 Weeks

Rabbit Polyclonal Anti-IRF9 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human IRF9
Interferon regulatory factor 9 (IRF9) Rabbit Polyclonal Antibody
TA329217

USD 375.00

5 Days

Rabbit Polyclonal anti-ISGF3G antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ISGF3G antibody: synthetic peptide directed towards the N terminal of human ISGF3G. Synthetic peptide located within the following region: PWKHAGKQDFREDQDAAFFKAWAIFKGKYKEGDTGGPAVWKTRLRCALNK