Anti-Murine VEGF Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Murine |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Murine VEGF |
Anti-Murine VEGF Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Murine |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Murine VEGF |
Rabbit Polyclonal Anti-RAB22A Antibody - middle region
Applications | IHC, WB |
Reactivities | Human, Murine |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RAB22A antibody: synthetic peptide directed towards the middle region of human RAB22A. Synthetic peptide located within the following region: IFVETSAKNAININELFIEISRRIPSTDANLPSGGKGFKLRRQPSEPKRS |
Anti-Murine RELMa Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Murine |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Murine RELMα |
Anti-Murine Leptin Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Murine |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Murine Leptin |
Anti-Murine RELMβ Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Murine |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Murine RELMβ |
Rabbit Polyclonal Anti-RAB14 Antibody
Applications | IHC, WB |
Reactivities | Human, Murin |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RAB14 antibody: synthetic peptide directed towards the C terminal of human RAB14. Synthetic peptide located within the following region: FLEAAKKIYQNIQDGSLDLNAAESGVQHKPSAPQGGRLTSEPQPQREGCG |