Products

View as table Download

Anti-Murine VEGF Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Murine
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Murine VEGF

Rabbit Polyclonal Anti-RAB22A Antibody - middle region

Applications IHC, WB
Reactivities Human, Murine
Conjugation Unconjugated
Immunogen The immunogen for anti-RAB22A antibody: synthetic peptide directed towards the middle region of human RAB22A. Synthetic peptide located within the following region: IFVETSAKNAININELFIEISRRIPSTDANLPSGGKGFKLRRQPSEPKRS

Anti-Murine RELMa Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Murine
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Murine RELMα

Anti-Murine Leptin Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Murine
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Murine Leptin

Anti-Murine RELMβ Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Murine
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Murine RELMβ

Rabbit Polyclonal Anti-RAB14 Antibody

Applications IHC, WB
Reactivities Human, Murin
Conjugation Unconjugated
Immunogen The immunogen for anti-RAB14 antibody: synthetic peptide directed towards the C terminal of human RAB14. Synthetic peptide located within the following region: FLEAAKKIYQNIQDGSLDLNAAESGVQHKPSAPQGGRLTSEPQPQREGCG