Products

Jump to Filters
View as table Download
CBX4 Rabbit Polyclonal Antibody
TA329637

USD 375.00

5 Days

Rabbit Polyclonal anti-CBX4 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CBX4 antibody: synthetic peptide directed towards the N terminal of human CBX4. Synthetic peptide located within the following region: LLIAFQNRERQEQLMGYRKRGPKPKPLVVQVPTFARRSNVLTGLQDSSTD
CBX4 Rabbit Polyclonal Antibody
TA352002

USD 345.00

In Stock

Rabbit Polyclonal Anti-CBX4 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CBX4