Products

Jump to Filters
View as table Download
Claudin 1 (CLDN1) (C-term) Rabbit Polyclonal Antibody
AP22702PU-N

USD 440.00

2 Weeks

Claudin 1 (CLDN1) (C-term) rabbit polyclonal antibody, Purified

Applications IHC
Reactivities Canine, Human, Monkey, Mouse, Rat
Immunogen CLDN1 antibody was raised against a synthetic peptide derived from the C-terminus of human Claudin-1
Claudin 1 (CLDN1) Rabbit Polyclonal Antibody
TA312397

USD 345.00

4 Weeks

Rabbit polyclonal anti-Claudin 1 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Claudin 1.
Claudin 1 (CLDN1) Rabbit Polyclonal Antibody
TA334200

USD 375.00

5 Days

Rabbit Polyclonal Anti-CLDN1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CLDN1 antibody: synthetic peptide directed towards the C terminal of human CLDN1. Synthetic peptide located within the following region: GQALFTGWAAASLCLLGGALLCCSCPRKTTSYPTPRPYPKPAPSSGKDYV
Claudin 1 (CLDN1) Rabbit Polyclonal Antibody
TA354265

USD 355.00

5 Days

Rabbit anti Claudin 1 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide from C-terminus of human claudin 1 protein.
Claudin 1 (CLDN1) Rabbit Polyclonal Antibody
TA321884

USD 345.00

In Stock

Anti-CLDN1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 196-209 amino acids of Human claudin 1
Claudin 1 (CLDN1) Rabbit Polyclonal Antibody
TA321885

USD 345.00

In Stock

Anti-CLDN1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 196-209 amino acids of Human claudin 1
CLDN1 Rabbit Polyclonal Antibody
TA384007

USD 380.00

4 Weeks

Claudin 1 Rabbit polyclonal Antibody

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Claudin 1. AA range:162-211