Products

View as table Download

Rabbit Polyclonal Anti-CSH1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CSH1 antibody: synthetic peptide directed towards the middle region of human CSH1. Synthetic peptide located within the following region: SMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYS

Rabbit Polyclonal Placental Lactogen Antibody

Applications ELISA, IF, IHC, WB
Reactivities Human
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

Placental lactogen (CSH1) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 180-208 amino acids from the C-terminal region of human CSH1

Carrier-free (BSA/glycerol-free) CSH1 mouse monoclonal antibody, clone OTI2G4 (formerly 2G4)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal hPL Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-CSH1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human CSH1

CSH1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human CSH1

Placental Lactogen Rabbit polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide from human protein at AA range: 161-210

CSH1 mouse monoclonal antibody, clone OTI2G4 (formerly 2G4)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

CSH1 mouse monoclonal antibody, clone OTI2G4 (formerly 2G4), Biotinylated

Applications IHC, WB
Reactivities Human
Conjugation Biotin

CSH1 mouse monoclonal antibody, clone OTI2G4 (formerly 2G4), HRP conjugated

Applications IHC, WB
Reactivities Human
Conjugation HRP

CSH1 mouse monoclonal antibody, clone OTI2G4 (formerly 2G4)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated