Products

View as table Download

GTF2H2 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat

Rabbit Polyclonal Anti-GTF2H2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GTF2H2 antibody: synthetic peptide directed towards the C terminal of human GTF2H2. Synthetic peptide located within the following region: CELPVECKICGLTLVSAPHLARSYHHLFPLDAFQEIPLEEYNGERFCYGC

GTF2H2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human GTF2H2