PLP1 (C-term) mouse monoclonal antibody, clone plpc1, Purified
Applications | FC, IF, IHC, WB |
Reactivities | Bovine, Human |
PLP1 (C-term) mouse monoclonal antibody, clone plpc1, Purified
Applications | FC, IF, IHC, WB |
Reactivities | Bovine, Human |
Rabbit Polyclonal Anti-PLP1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PLP1 antibody: synthetic peptide directed towards the N terminal of human PLP1. Synthetic peptide located within the following region: GHEALTGTEKLIETYFSKNYQDYEYLINVIHAFQYVIYGTASFFFLYGAL |
Rabbit Polyclonal Anti-PLP1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PLP1 antibody: synthetic peptide directed towards the middle region of human PLP1. Synthetic peptide located within the following region: IYGTASFFFLYGALLLAEGFYTTGAVRQIFGDYKTTICGKGLSATVTGGQ |
PLP1 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 145-210 of human PLP1 (NP_955772.1). |
Modifications | Unmodified |
PLP1 Rabbit polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 145-210 of human PLP1 (NP_955772.1). |
Modifications | Unmodified |