Products

Jump to Filters
View as table Download
PSMD8 Rabbit Polyclonal Antibody
TA346574

USD 475.00

5 Days

Rabbit Polyclonal Anti-PSMD8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PSMD8 antibody: synthetic peptide directed towards the C terminal of human PSMD8. Synthetic peptide located within the following region: DYAKKRGWVLGPNNYYSFASQQQKPEDTTIPSTELAKQVIEYARQLEMIV
PSMD8 Rabbit Polyclonal Antibody
TA380470

USD 220.00

3 Weeks

PSMD8 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 101-350 of human PSMD8 (NP_002803.2).
Modifications Unmodified