Rabbit polyclonal CNBP Antibody (Center)
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | This CNBP antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 91-118 amino acids from the Central region of human CNBP. |
Goat Polyclonal Antibody against CNBP
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence GESGHLARECTIE, from the C Terminus of the protein sequence according to NP_003409.1. |
Rabbit Polyclonal Anti-CNBP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CNBP antibody: synthetic peptide directed towards the N terminal of human CNBP. Synthetic peptide located within the following region: SSNECFKCGRSGHWARECPTGGGRGRGMRSRGRGGFTSDRGFQFVSSSLP |
CNBP Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 100 to the C-terminus of human CNBP (NP_001120668.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
