Products

View as table Download

Rabbit Polyclonal FMNL2 Antibody

Applications IHC, WB
Reactivities Human, Rat, Primate
Conjugation Unconjugated
Immunogen A portion of amino acid 1-50 of human Formin-like protein 2 was used as the immunogen.

Rabbit Polyclonal Anti-FMNL2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FMNL2 antibody is: synthetic peptide directed towards the middle region of Human FMNL2. Synthetic peptide located within the following region: RFVKAYKQAEEENELRKKQEQALMEKLLEQEALMEQQDPKSPSHKSKRQQ

Rabbit Polyclonal Anti-FMNL2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FMNL2 antibody: synthetic peptide directed towards the N terminal of human FMNL2. Synthetic peptide located within the following region: MGNAGSMDSQQTDFRAHNVPLKLPMPEPGELEERFAIVLNAMNLPPDKAR